Glycerate kinase I (c.141.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Glycerate kinase I
Superfamily: Glycerate kinase I
Family: Glycerate kinase I



Orphan Member
 
Domain: d1to6b_ of protein: Glycerate kinase GlxK from Species: Neisseria meningitidis, (serogroup A) [TaxId: 487]




>1to6b_(c.141.1.1)
MKIVIAPDSFKESLTAQQVAEAIKRGFQQSIADVECLLCPVGDGGEGTVDAIRHSLDLEEKCLQVTGSFGQKEVMRYFQKEQLALFEVADLVGLGKIPLEKRNPLQIQTRGIGELIRHLISQEIKEIYIGVGGTASNDGGIGIAAGLGYQFYDEDGNALPACGQSLLNLASVSTENRYKIPEDVHIRILADVVSPLCGHQGATYTFGKQKGLDSTMFEVVDQAIQDFYEKVSPATLKLKGAGAGGGIAGGLCAFAQASIVSGIDTCLDLIDFDKKVSDVDLVIVGEGRLDRQSLAGKAPIGVAKRTPVGVPVVAICGSLVEDLPSLPFENIQAAFSILEKSEPLEDSLKNASLYLEHTASNIGHLLNMPKI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)