CAC2185-like (c.147.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: CAC2185-like
Superfamily: CAC2185-like
Family: CAC2185-like



Orphan Member
 
Domain: d2g6tb_ of protein: Hypothetical protein CAC2185 from Species: Clostridium acetobutylicum [TaxId: 1488]




>2g6tb1(c.147.1.1)
MYKCLIWGVNDEYTLAYDKLLFEISKGNLSIEALISKDKYAKYIDGKEVIDKTEISNYEFDYIIIFNKERYSDIKNEALELGIPERKILNGKFFFISNFDFKRYCKLIENPITIISDDCWGGLVSSYLGFKFNSPFINFYIHNDDYIKFLENMDYYLEQELKVEQEGNVYSCTMPKGSLGTGDNKIILNFNHQASFAEAKNDWDERKTRINKKNLFVKMLIKDDNEKLVKRFDNLPYKNKVCFHPKPMKYKSVAFFPRYIWRCINYAARTSNSNLEQYTMDMSWLEKSCDILKMLCGEEDFIREK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)