YerB-like (c.153.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: YerB-like
Superfamily: YerB-like
Family: YerB-like



Orphan Member
 
Domain: d2psba1 of protein: Uncharacterized protein YerB from Species: Bacillus subtilis [TaxId: 1423]




>d2psba1|c.153.1.1
KLKAPLTGLKTEQKVTERRPVAVVVNNHPKARPQSGLSKADIVIEALAEGQITRFLAIFQ
SQPETVGPVRSAREYFVTLSNGFDSIFVHHGWSPGAKKQLESGAADYNGLDFDGSLFWRA
DFSKPPHNSYTSYDYIKKAAEQKGYKLKQETNPLLFQTNESYNVRVDYGTNNVTNLVEYN
YDKKAEFYTRSSDGVITTDRETGKPVAQNIFIVEASHHIIDQDGRRDIDLESGGKGLLFQ
HGNVIETDWKQVNGRIVPVKDGKWLPFVPGKTWINIVPDLDAASISK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)