Gingipain R (RgpB), N-terminal domain (c.17.1.2)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Caspase-like
Superfamily: Caspase-like
Family: Gingipain R (RgpB), N-terminal domain



Orphan Member
 
Domain: d4iefh1 of protein: automated matches from Species: Porphyromonas gingivalis [TaxId: 242619]




>1cvra2(c.17.1.2)
YTPVEEKENGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTVAIIASTIDQYWAPPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGENMLDTWTVFGDPSLLVRTLV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)