Aspartyl dipeptidase PepE (c.23.16.4)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Flavodoxin-like
Superfamily: Class I glutamine amidotransferase-like
Family: Aspartyl dipeptidase PepE



Orphan Member
 
Domain: d1fyea_ of protein: Aspartyl dipeptidase PepE from Species: Salmonella typhimurium [TaxId: 90371]




>1fyea_(c.23.16.4)
MELLLLSNSTLPGKAWLEHALPLIANQLNGRRSAVFIPFAGVTQTWDEYTDKTAEVLAPLGVNVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLQINPHFTNTREQRIRELLVVAPELTVIGLPEGNWIQVSNGQAVLGGPNTTWVFKAGEEAVALEAGHRF

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)