A4 beta-galactosidase middle domain (c.23.16.5)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Flavodoxin-like
Superfamily: Class I glutamine amidotransferase-like
Family: A4 beta-galactosidase middle domain



Orphan Member
 
Domain: d1kwka3 of protein: A4 beta-galactosidase middle domain from Species: Thermus thermophilus [TaxId: 274]




>1kwga3(c.23.16.5)
PVAQAPVALVFDYEAAWIYEVQPQGAEWSYLGLVYLFYSALRRLGLDVDVVPPGASLRGYAFAVVPSLPIVREEALEAFREAEGPVLFGPRSGSKTETFQIPKELPPGPLQALLPLKVVRVESLPPGLLEVAEGALGRFPLGLWREWVEAPLKPLLTFQDGKGALYREGRYLYLAAWPSPELAGRLLSALAAEAGLK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)