Prokaryotic glutathione synthetase, N-terminal domain (c.30.1.3)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: PreATP-grasp domain
Superfamily: PreATP-grasp domain
Family: Prokaryotic glutathione synthetase, N-terminal domain



Orphan Member
 
Domain: d2glta1 of protein: Prokaryotic glutathione synthetase, N-terminal domain from Species: Escherichia coli [TaxId: 562]




>1gsha1(c.30.1.3)
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVKQNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLRDC

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)