ACDE2-like (c.31.1.6)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: DHS-like NAD/FAD-binding domain
Superfamily: DHS-like NAD/FAD-binding domain
Family: ACDE2-like



Orphan Member
 
Domain: d1ytld_ of protein: Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 from Species: Archaeoglobus fulgidus [TaxId: 2234]




>1ytlc1(c.31.1.6)
MATLLEKGKPVANMIKKAKRPLLIVGPDMTDEMFERVKKFVEKDITVVATGSAITRFIDAGLGEKVNYAVLHELTQFLLDPDWKGFDGQGNYDLVLMLGSIYYHGSQMLAAIKNFAPHIRALAIDRYYHPNADMSFGNLWKKEEDYLKLLDEILAEL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)