spliceosomal protein U5-15Kd (c.47.1.8)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Thioredoxin fold
Superfamily: Thioredoxin-like
Family: spliceosomal protein U5-15Kd



Orphan Member
 
Domain: d2av4a1 of protein: automated matches from Species: Plasmodium yoelii [TaxId: 5861]




>1qgva_(c.47.1.8)
SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYST

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)