PA4535-like (c.52.1.31)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Restriction endonuclease-like
Superfamily: Restriction endonuclease-like
Family: PA4535-like



Orphan Member
 
Domain: d1y0ka1 of protein: Hypothetical protein PA4535 from Species: Pseudomonas aeruginosa [TaxId: 287]




>1y0ka1(c.52.1.31)
MNEADYLRLLTRQAEQANDFLSNARKWDRERWVCQRFLEALNVPYRQEDFAAPGEQPPDVLFKGAGFEVFFVLDERPQRIAAAELQARLAPTLRKKAHNYSERGIDHGELDLLAFVNLKRAVPDFNTPFPPPTEYLRQGWRSLSMVGPTFARVLFAHSGAPEFLRANLGRSILFDAGVGL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)