Methylene-tetrahydromethanopterin dehydrogenase (c.58.1.4)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Aminoacid dehydrogenase-like, N-terminal domain
Superfamily: Aminoacid dehydrogenase-like, N-terminal domain
Family: Methylene-tetrahydromethanopterin dehydrogenase



Orphan Member
 
Domain: d1luac2 of protein: Methylene-tetrahydromethanopterin dehydrogenase from Species: Methylobacterium extorquens [TaxId: 408]




>1luac2(c.58.1.4)
SKKLLFQFDTDATPSVFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVKKRFFGPFRVSCMLDSN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)