RoRNP C-terminal domain-like (c.62.1.5)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: vWA-like
Superfamily: vWA-like
Family: RoRNP C-terminal domain-like



Orphan Member
 
Domain: d2i91b2 of protein: 60-kda SS-A/Ro ribonucleoprotein, RoRNP from Species: African clawed frog (Xenopus laevis) [TaxId: 8355]




>1yvra2(c.62.1.5)
VEPTGKRFLLAIDVSASMNQRVLGSILNASVVAAAMCMLVARTEKDSHMVAFSDEMLPCPITVNMLLHEVVEKMSDITMGSTDCALPMLWAQKTNTAADIFIVFTDCETNVEDVHPATALKQYREKMGIPAKLIVCAMTSNGFSIADPDDRGMLDICGFDSGALDVIRNFTLDL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)