Pyruvate-ferredoxin oxidoreductase, PFOR, domain III (c.64.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III
Superfamily: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III
Family: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III



Orphan Member
 
Domain: d2uzab4 of protein: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III from Species: Desulfovibrio africanus [TaxId: 873]




>2c42b4(c.64.1.1)
GTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLVNRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINMIMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKNVVKPILTQQGDKLPVSAFEADGRFPLG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)