Hypothetical Protein YjhP (c.66.1.21)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: S-adenosyl-L-methionine-dependent methyltransferases
Superfamily: S-adenosyl-L-methionine-dependent methyltransferases
Family: Hypothetical Protein YjhP



Orphan Member
 
Domain: d1nkvc_ of protein: Hypothetical Protein YjhP from Species: Escherichia coli [TaxId: 562]




>1nkva_(c.66.1.21)
PRIFTISESEHRIHNPFTEEKYATLGRVLRMKPGTRILDLGSGSGEMLCTWARDHGITGTGIDMSSLFTAQAKRRAEELGVSERVHFIHNDAAGYVANEKCDVAACVGATWIAGGFAGAEELLAQSLKPGGIMLIGEPYWRQLPATEEIAQACGVSSTSDFLTLPGLVGAFDDLGYDVVEMVLADQEGWDRYEAAKWLTMRRWLEANPDDDFAAEVRAELNIAPKRYVTYARECFGWGVFALIAR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)