rRNA methyltransferase RlmA (c.66.1.33)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: S-adenosyl-L-methionine-dependent methyltransferases
Superfamily: S-adenosyl-L-methionine-dependent methyltransferases
Family: rRNA methyltransferase RlmA



Orphan Member
 
Domain: d1p91b_ of protein: rRNA methyltransferase RlmA from Species: Escherichia coli [TaxId: 562]




>1p91b_(c.66.1.33)
SFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPDSAEMMQARRAFLDAGHYQPLRDAIVAQLRERLDDKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKVAIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPGPRHLMELKGLIYNEVHLHAPHAEQLEGFTLQQSAELCYPMRLRGDEAVALLQMTPFAWRAKPEVWQTLAAKEVFDCQTDFNIHLWQRSY

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)