mRNA cap (Guanine N-7) methyltransferase (c.66.1.34)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: S-adenosyl-L-methionine-dependent methyltransferases
Superfamily: S-adenosyl-L-methionine-dependent methyltransferases
Family: mRNA cap (Guanine N-7) methyltransferase



Orphan Member
 
Domain: d2hv9a_ of protein: mRNA cap (Guanine N-7) methyltransferase from Species: Fungus (Encephalitozoon cuniculi) [TaxId: 6035]




>1ri5a_(c.66.1.34)
SKTINIRNANNFIKACLIRLYTKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSINDARVRARNMKRRFKVFFRAQDSYGRHMDLGKEFDVISSQFSFHYAFSTSESLDIAQRNIARHLRPGGYFIMTVPSRDVILERYKQGRMSNDFYKIELEKMEDVPMESVREYRFTLLDSVNNCIEYFVDFTRMVDGFKRLGLSLVERKGFIDFYEDEGRRNPELSKKMGLGCLTREESEVVGIYEVVVFRKL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)