TTHA0179-like (c.68.1.19)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Nucleotide-diphospho-sugar transferases
Superfamily: Nucleotide-diphospho-sugar transferases
Family: Spore coat polysaccharide biosynthesis protein SpsA



Orphan Member
 
Domain: d1qgsa_ of protein: Spore coat polysaccharide biosynthesis protein SpsA from Species: Bacillus subtilis [TaxId: 1423]




>1qgqa_(c.68.1.1)
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITEFVRNLPPQRNCRELRESLKKLGMG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)