Glycogenin (c.68.1.14)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Nucleotide-diphospho-sugar transferases
Superfamily: Nucleotide-diphospho-sugar transferases
Family: Glycogenin



Orphan Member
 
Domain: d3u2xb_ of protein: Glycogenin from Species: Human (Homo sapiens) [TaxId: 9606]




>1ll2a_(c.68.1.14)
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRTHPQFLNVWWDIFTTSVVPLLQQ

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)