mannose-1-phosphate guanylyl transferase (c.68.1.20)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Nucleotide-diphospho-sugar transferases
Superfamily: Nucleotide-diphospho-sugar transferases
Family: beta 1,4 galactosyltransferase (b4GalT1)



Orphan Member
 
Domain: d4l41c_ of protein: automated matches from Species: Human (Homo sapiens) [TaxId: 9606]




>1yrod1(c.68.1.2)
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNKAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKTRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)