A novel bacterial esterase (c.69.1.15)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: alpha/beta-Hydrolases
Superfamily: alpha/beta-Hydrolases
Family: A novel bacterial esterase



Orphan Member
 
Domain: d2wkwb_ of protein: automated matches from Species: Alcaligenes sp. [TaxId: 512]




>1qlwb_(c.69.1.15)
VPKTPAGPLTLSGQGSFFVGGRDVTSETLSLSPKYDAHGTVTVDQMYVRYQIPQRAKRYPITLIHGCCLTGMTWETTPDGRMGWDEYFLRKGYSTYVIDQSGRGRSATDISAINAVKLGKAPASSLPDLFAAGHEAAWAIFRFGPRYPDAFKDTQFPVQAQAELWQQMVPDWLGSMPTPNPTVANLSKLAIKLDGTVLLSHSQSGIYPFQTAAMNPKGITAIVSVEPGECPKPEDVKPLTSIPVLVVFGDHIEEFPRWAPRLKACHAFIDALNAAGGKGQLMSLPALGVHGNSHMMMQDRNNLQVADLILDWIGRNT

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)