Ccg1/TafII250-interacting factor B (Cib) (c.69.1.23)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: alpha/beta-Hydrolases
Superfamily: alpha/beta-Hydrolases
Family: Ccg1/TafII250-interacting factor B (Cib)



Orphan Member
 
Domain: d1imja_ of protein: Ccg1/TafII250-interacting factor B (Cib) from Species: Human (Homo sapiens) [TaxId: 9606]




>1imja_(c.69.1.23)
AASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)