YdeN-like (c.69.1.31)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: alpha/beta-Hydrolases
Superfamily: alpha/beta-Hydrolases
Family: YdeN-like



Orphan Member
 
Domain: d1uxoa_ of protein: Hypothetical protein YdeN from Species: Bacillus subtilis [TaxId: 1423]




>1uxoa_(c.69.1.31)
TKQVYIIHGYRASSTNHWFPWLKKRLLADGVQADILNMPNPLQPRLEDWLDTLSLYQHTLHENTYLVAHSLGCPAILRFLEHLQLRAALGGIILVSGFAKSLPTLQMLDEFTQGSFDHQKIIESAKHRAVIASKDDQIVPFSFSKDLAQQIDAALYEVQHGGHFLEDEGFTSLPIVYDVLTSYFSK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)