Hypothetical esterase YJL068C (c.69.1.34)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: alpha/beta-Hydrolases
Superfamily: alpha/beta-Hydrolases
Family: Hypothetical esterase YJL068C



Orphan Member
 
Domain: d4fold_ of protein: automated matches from Species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]




>1pv1d_(c.69.1.34)
MKVVKEFSVCGGRLIKLSHNSNSTKTSMNVNIYLPKHYYAQDFPRNKRIPTVFYLSGLTCTPDNASEKAFWQFQADKYGFAIVFPDTSPRGDEVANDPEGSWDFGQGAGFYLNATQEPYAQHYQMYDYIHKELPQTLDSHFNKLDFLDNVAITGHSMGGYGAICGYLKGYSGKRYKSCSAFAPIVNPSNVPWGQKAFKGYLGEWEAYDPCLLIKNIRHVGDDRILIHVGDSDPFLEEHLKPELLLEAVKATSWQDYVEIKKVHGFDHSYYFVSTFVPEHAEFHARNLGLI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)