Hypothetical protein VC1974 (c.69.1.35)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: alpha/beta-Hydrolases
Superfamily: alpha/beta-Hydrolases
Family: Hypothetical protein VC1974



Orphan Member
 
Domain: d1r3da_ of protein: Hypothetical protein VC1974 from Species: Vibrio cholerae [TaxId: 666]




>1r3da_(c.69.1.35)
SSLLSNQLHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPAEAVEMIEQTVQAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSSVAHMLLATSLAKQPYLLPALQALKLPIHYVCGEQDSKFQQLAESSGLSYSQVAQAGHNVHHEQPQAFAKIVQAMIHSIID

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)