Phosphonoacetate hydrolase (c.76.1.4)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Alkaline phosphatase-like
Superfamily: Alkaline phosphatase-like
Family: Phosphonoacetate hydrolase



Orphan Member
 
Domain: d1ei6d_ of protein: Phosphonoacetate hydrolase from Species: Pseudomonas fluorescens [TaxId: 294]




>1ei6d_(c.76.1.4)
TNLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICGNFFFDEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARVGMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGMNAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGLTVPLRSHGGVSEQKVPLIFNRKLVGLDRLRNFDIIDLALNHLA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)