DeoB catalytic domain-like (c.76.1.5)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Alkaline phosphatase-like
Superfamily: Alkaline phosphatase-like
Family: DeoB catalytic domain-like



Orphan Member
 
Domain: d4n7tb1 of protein: Phosphopentomutase DeoB from Species: Streptococcus mutans [TaxId: 1309]




>2i09b1(c.76.1.5)
STFNRIHLVVLDSVGIGAAPDANNFSNAGVPDGASDTLGHISKTVGLNVPNMAKIGLGNIPRDTPLKTVPAENHPTGYVTKLEEVSLGKDTMTGHWEIMGLNITEPSPFAPTVLNKLADAGVSTYAVGKINDIFNGSGITNDMGHNKSNSHGVDTLIKTMGLSAFTKGFSFTNLVDFDALYGHRRNAHGYRDCLHEFDERLPEIIAAMKVDDLLLITADHGNDPTYAGTDHTREYVPLLAYSPSFTGNGVLPVGHYADISATIADNFGVDTAMIGESFLDKLI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)