automated matches (c.8.5.0)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: The "swivelling" beta/beta/alpha domain
Superfamily: GroEL apical domain-like
Family: automated matches



Orphan Member
 
Domain: d3m6ca_ of protein: automated matches from Species: Mycobacterium tuberculosis [TaxId: 83332]




>d3m6ca_|c.8.5.0
ELEFTEGIGFDKGFLSAYFVTDFDNQQAVLEDALILLHQDKISSLPDLLPLLEKVAGTGK
PLLIVAEDVEGEALATLVVNAIRKTLKAVAVKGPYFGDRRKAFLEDLAVVTGGQVVNPDA
GMVLREVGLEVLGSARRVVVSKDDTVIVDGGGTAEAVANRAKHLRAEIDKSDSDWDREKL
GERLAKLAGGVAVI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)