FumA C-terminal domain-like (c.8.9.1)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: The "swivelling" beta/beta/alpha domain
Superfamily: FumA C-terminal domain-like
Family: FumA C-terminal domain-like



Orphan Member
 
Domain: d2isba_ of protein: Fumarate hydratase class I beta subunit from Species: Archaeoglobus fulgidus [TaxId: 2234]




>2isba1(c.8.9.1)
VMEYELRTPLVKDQILKLKVGDVVYITGEIFTARDEAHARALEWMEEGKELPFSFDKGVVYHCGPLVKKNDEWRVVSAGPTTSARMNPFTPKILEKVECMGIIGKGGMSEEVVEAMRGKAAYFAFTGGAGALAAMSIKKVKGVVWEDLGMPEAVWLLEVERFGPCIVAIDAHGNSLYR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)