automated matches (c.89.1.0)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Phosphofructokinase
Superfamily: Phosphofructokinase
Family: automated matches



Orphan Member
 
Domain: d1zxxa_ of protein: automated matches from Species: Lactobacillus delbrueckii [TaxId: 1585]




>d1zxxa_|c.89.1.0
MKRIGILTSGGDAPGMNAAVRAVTRVAIANGLEVFGIRYGFAGLVAGDIFPLESEDVAHL
INVSGTFLYSARYPEFAEEEGQLAGIEQLKKHGIDAVVVIGGDGSYHGALQLTRHGFNSI
GLPGTIDNDIPYTDATIGYDTACMTAMDAIDKIRDTASSHHRVFIVNVMGRNCGDIAMRV
GVACGADAIVIPERPYDVEEIANRLKQAQESGKDHGLVVVAEGVMTADQFMAELKKYGDF
DVRANVLGHMQRGGTPTVSDRVLASKLGSEAVHLLLEGKGGLAVGIENGKVTSHDILDLF
DESHRGDYDLLKLNADLSR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)