Periplasmic ferric siderophore binding protein FhuD (c.92.2.1)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Chelatase-like
Superfamily: "Helical backbone" metal receptor
Family: Periplasmic ferric siderophore binding protein FhuD



Orphan Member
 
Domain: d1k7sn_ of protein: Periplasmic ferric siderophore binding protein FhuD from Species: Escherichia coli [TaxId: 562]




>1efdn_(c.92.2.1)
GIDPNRIVALEWLPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRVLDNAIG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)