Dipeptide transport protein (c.99.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Dipeptide transport protein
Superfamily: Dipeptide transport protein
Family: Dipeptide transport protein



Orphan Member
 
Domain: d1hi9e_ of protein: Zn-dependent D-aminopeptidase DppA from Species: Bacillus subtilis [TaxId: 1423]




>1hi9e_(c.99.1.1)
MKLYMSVDMEGISGLPDDTFVDSGKRNYERGRLIMTEEANYCIAEAFNSGCTEVLVNDSHSKMNNLMVEKLHPEADLISGDVKPFSMVEGLDDTFRGALFLGYHARASTPGVMSHSMIFGVRHFYINDRPVGELGLNAYVAGYYDVPVLMVAGDDRAAKEAEELIPNVTTAAVKQTISRSAVKCLSPAKRGRLLTEKTAFALQNKDKVKPLTPPDRPVLSIEFANYGQAEWANLMPGTEIKTGTTTVQFQAKDMLEAYQAMLVMTELAMRTSFC

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)