DNA-binding domain from tn916 integrase (d.10.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: DNA-binding domain
Superfamily: DNA-binding domain
Family: DNA-binding domain from tn916 integrase



Orphan Member
 
Domain: d2bb8a_ of protein: DNA-binding domain from tn916 integrase from Species: Enterococcus faecalis [TaxId: 1351]




>1tn9a_(d.10.1.1)
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDAISLREKIAELQKDI

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)