GCC-box binding domain (d.10.1.2)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: DNA-binding domain
Superfamily: DNA-binding domain
Family: GCC-box binding domain



Orphan Member
 
Domain: d3gcca_ of protein: GCC-box binding domain from Species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]




>3gcca_(d.10.1.2)
KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)