Coatomer appendage domain (d.105.1.2)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Subdomain of clathrin and coatomer appendage domain
Superfamily: Subdomain of clathrin and coatomer appendage domain
Family: Coatomer appendage domain



Orphan Member
 
Domain: d1r4xa2 of protein: Coatomer gamma subunit, C-terminal subdomain from Species: Human (Homo sapiens) [TaxId: 9606]




>1r4xa2(d.105.1.2)
HIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDTVTMQVTARSLEELPVDIILASV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)