Hypothetical protein cg14615-pa (d.108.1.5)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Acyl-CoA N-acyltransferases (Nat)
Superfamily: Acyl-CoA N-acyltransferases (Nat)
Family: Hypothetical protein cg14615-pa



Orphan Member
 
Domain: d1sqha_ of protein: Hypothetical protein cg14615-pa from Species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]




>1sqha_(d.108.1.5)
GDILRPLSDSEVDELLDLYKVKFGIRNFHYLLLYNQRKWDRQLSEAQIPRNDLNHISLRKQFYTHRRGNFRTWGTYVSLHRDIVQSVSFFSWQPDGAAELWECLEQTQLIEWTQGALLTNVDLGFCNRVKELAVSRGVTAIQPRQCFGMVLSHEDAFCAKVPDLPSEFEIRRLRAEDAAMVHDSWPNKGEGSLTYLQALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGLGGLLAAAMSREIARGEEITLTAWIVATNWRSEALLKRIGYQKDLVNEWIKLVPNS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)