Ornithine decarboxylase antizyme-like (d.108.1.7)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Acyl-CoA N-acyltransferases (Nat)
Superfamily: Acyl-CoA N-acyltransferases (Nat)
Family: Ornithine decarboxylase antizyme-like



Orphan Member
 
Domain: d1zo0a1 of protein: Ornithine decarboxylase antizyme from Species: Norway rat (Rattus norvegicus) [TaxId: 10116]




>1zo0a1(d.108.1.7)
ILYSDERLNVTEEPTSNDKTRVLSIQCTLTEAKQVTWRAVWNGGGLYIELPAGPLPEGSKDSFAALLEFAEEQLRADHVFICFPKNREDRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMVYTLE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)