FLJ32549 C-terminal domain-like (d.109.3.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Gelsolin-like
Superfamily: FLJ32549 C-terminal domain-like
Family: FLJ32549 C-terminal domain-like



Orphan Member
 
Domain: d2gnxa2 of protein: Hypothetical protein BC048403 from Species: Mouse (Mus musculus) [TaxId: 10090]




>d2gnxa2|d.109.3.1
PDLFGKISSFIRKYDAANVSLIFDQYPAVVSLPSDRPVHWPNVIITDRASDLNSLEKVVH
FYDDKVQSTYFLTRPEPHFTIVVIFESKKSERDSHFISFLNELSLALKNPKVFASLK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)