YNR034W-A-like (d.110.10.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Profilin-like
Superfamily: YNR034W-A-like
Family: YNR034W-A-like



Orphan Member
 
Domain: d2grga1 of protein: Uncharacterized protein YNR034W-A from Species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]




>d2grga1|d.110.10.1
MKSSIPITEVLPRAVGSLTFDENYNLLDTSGVAKVIEKSPIAEIIRKSNAELGRLGYSVY
EDAQYIGHAFKKAGHFIVYFTPKNKNREGVVPPVGITN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)