HrcA C-terminal domain-like (d.110.2.3)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Profilin-like
Superfamily: GAF domain-like
Family: HrcA C-terminal domain-like



Orphan Member
 
Domain: d1stzc2 of protein: Heat-inducible transcription repressor HrcA, C-terminal domain from Species: Thermotoga maritima [TaxId: 2336]




>1stzc2(d.110.2.3)
MPLADPEKVLFLAGNLLARLTEGYVLIERPNTRDLKILRVMLIPVSEDYLIFSILTEFGVSKVTPIKTQERLNWEEIERQLNFLLRGRTVGEVLMGKIESLKGSGFLRLIESLIGETVERYLDAGLENLLKDETLTLEDIRNLLEEVKDQKFLESLVGEGITVRIGREIGRKKLEKFAVFSGKYFKGESPIGSVYLFTSKVTKYDRNHRVFEYILNRLSEYFTSTS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)