Pheromone-binding domain of LuxR-like quorum-sensing transcription factors (d.110.5.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Profilin-like
Superfamily: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors
Family: Pheromone-binding domain of LuxR-like quorum-sensing transcription factors



Orphan Member
 
Domain: d1l3ld2 of protein: Transcription factor TraR, N-terminal domain from Species: Agrobacterium tumefaciens [TaxId: 358]




>1l3ld2(d.110.5.1)
MQHWLDKLTDLAAIEGDECILKTGLADIADHFGFTGYAYLHIQHRHITAVTNYHRQWQSTYFDKKFEALDPVVKRARSRKHIFTWSGEHERPTLSKDERAFYDHASDFGIRSGITIPIKTANGFMSMFTMASDKPVIDLDREIDAVAAAATIGQIHARISFL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)