Anion transport protein, cytoplasmic domain (d.112.1.2)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Phoshotransferase/anion transport protein
Superfamily: Phoshotransferase/anion transport protein
Family: Anion transport protein, cytoplasmic domain



Orphan Member
 
Domain: d4ky9p_ of protein: automated matches from Species: Human (Homo sapiens) [TaxId: 9606]




>1hyns_(d.112.1.2)
KVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQ

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)