Vaccinia DNA topoisomerase I, 9 kDa N-terminal fragment (d.121.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: DNA topoisomerase I domain
Superfamily: DNA topoisomerase I domain
Family: Vaccinia DNA topoisomerase I, 9 kDa N-terminal fragment



Orphan Member
 
Domain: d1vcca_ of protein: Vaccinia DNA topoisomerase I, 9 kDa N-terminal fragment from Species: Vaccinia virus, strain WR [TaxId: 10245]




>1vcca_(d.121.1.1)
MRALFYKDGKLFTDNNFLNPVSDDNPAYEVLQHVKIPTHLTDVVVYEQTWEEALTRLIFVGSDSKGRRQYFYGKMHV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)