Ornithine decarboxylase C-terminal domain (d.125.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Ornithine decarboxylase C-terminal domain
Superfamily: Ornithine decarboxylase C-terminal domain
Family: Ornithine decarboxylase C-terminal domain



Orphan Member
 
Domain: d1ordb3 of protein: Ornithine decarboxylase C-terminal domain from Species: Lactobacillus sp., strain 30a [TaxId: 1591]




>1c4ka3(d.125.1.1)
APLKQVLPSIYAANEERYNGYTIRELCQELHDFYKNNNTFTYQKRLFLREFFPEQGMLPYEARQEFIRNHNKLVPLNKIEGEIALEGALPYPPGVFCVAPGEKWSETAVKYFTILQDGINNFPGFAPEIQGVYFKQEGDKVVAYGEVYDAEVAKNDDRYNN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)