MoaD-related protein, C-terminal domain (d.129.5.1)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: TBP-like
Superfamily: MoaD-related protein, C-terminal domain
Family: MoaD-related protein, C-terminal domain



Orphan Member
 
Domain: d1v8cd2 of protein: MoaD-related protein, C-terminal domain from Species: Thermus thermophilus [TaxId: 274]




>1v8cb2(d.129.5.1)
GFERTFGAFPPWLLERYLEEWGGTREGEGVYRLPGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFAAS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)