automated matches (d.129.6.0)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: TBP-like
Superfamily: KA1-like
Family: automated matches



Orphan Member
 
Domain: d4eaga_ of protein: automated matches from Species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]




>d4eaga_|d.129.6.0
AKWHLGIRSQSKPNDIMLEVYRAMKALSYEWKIINPYHVRVRRQNVKTGKFSKMSLQLYQ
VDAKSYLLDFKSLTLQPTGHHTMEFFEMCAALIIQLAR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)