Formaldehyde-activating enzyme, FAE (d.14.1.12)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Ribosomal protein S5 domain 2-like
Superfamily: Ribosomal protein S5 domain 2-like
Family: Formaldehyde-activating enzyme, FAE



Orphan Member
 
Domain: d1y60e_ of protein: Formaldehyde-activating enzyme, FAE from Species: Methylobacterium extorquens [TaxId: 408]




>1y60e_(d.14.1.12)
AKITKVQVGEALVGDGNEVAHIDLIIGPRGSPAETAFCNGLVNNKHGFTSLLAVIAPNLPCKPNTLMFNKVTINDARQAVQMFGPAQHGVAMAVQDAVAEGIIPADEADDLYVLVGVFIHWEAADDAKIQKYNYEATKLSIQRAVNGEPKASVVTEQRKSATHPFAAN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)