Lysine biosynthesis enzyme LysX ATP-binding domain (d.142.1.7)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: ATP-grasp
Superfamily: Glutathione synthetase ATP-binding domain-like
Family: Lysine biosynthesis enzyme LysX ATP-binding domain



Orphan Member
 
Domain: d3vpdb2 of protein: automated matches from Species: Thermus thermophilus [TaxId: 274]




>1uc8b2(d.142.1.7)
KWATSVALAKAGLPQPKTALATDREEALRLMEAFGYPVVLKPVIXXXXXXXXXXXXGFQHQLFYIQEYVEKPGRDIRVFVVGERAIAAIYRAENCPLTEEVARLSVKAAEAVGGGVVAVDLFESERGLLVNEVNHTMEFKNSVHTTGVDIPGEILKYAWSLAS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)