APG12-like (d.15.1.7)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: beta-Grasp (ubiquitin-like)
Superfamily: Ubiquitin-like
Family: APG12-like



Orphan Member
 
Domain: d1wz3b_ of protein: automated matches from Species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]




>1wz3b1(d.15.1.7)
QKIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLHSDSLFVYVNSAFSPNPDESVIDLYNNFGFDGKLVVNYACSMAW

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)