Penicillin V acylase (d.153.1.3)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: Ntn hydrolase-like
Superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family: Penicillin V acylase



Orphan Member
 
Domain: d3pvah_ of protein: Penicillin V acylase from Species: Bacillus sphaericus [TaxId: 1421]




>2pvad_(d.153.1.3)
CSSLSIRTTDDKSLFARTMDFTMEPDSKVIIVPRNYGIRLLEKENVVINNSYAFVGMGSTDITSPVLYDGVNEKGLMGAMLYYATFATYADEPKKGTTGINPVYVISQVLGNCVTVDDVIEKLTSYTLLNEANIILGFAPPLHYTFTDASGESIVIEPDKTGITIHRKTIGVMTNSPGYEWHQTNLRAYIGVTPNPPQDIMMGDLDLTPFGQGAGGLGLPGDFTPSARFLRVAYWKKYTEKAKNETEGVTNLFHILSSVNIPKGVVLTNEGKTDYTIYTSAMCAQSKNYYFKLYDNSRISAVSLMAENLNSQDLITFEWDRKQDIKQLNQVN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)