Electron transfer flavoprotein-ubiquinone oxidoreductase-like (d.16.1.8)


SCOP classification
 
Class: Alpha and beta proteins (a+b)
Fold: FAD-linked reductases, C-terminal domain
Superfamily: FAD-linked reductases, C-terminal domain
Family: Electron transfer flavoprotein-ubiquinone oxidoreductase-like



Orphan Member
 
Domain: d2gmjb2 of protein: Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO from Species: Pig (Sus scrofa) [TaxId: 9823]




>2gmhb2(d.16.1.8)
TYGIGLKELWVIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGGKRIAYGARALNE

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)